PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P29230_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 452aa    MW: 50589.4 Da    PI: 6.3036
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P29230_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-093724091954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+ +e+  LA+++gLt +qV++WF N R +
  GSMUA_Achr3P29230_001 372 FEHflHPYPKDSEKLVLARQTGLTRSQVSNWFINARVR 409
                            664559******************************88 PP

2BELL113.41.2e-36235306172
                   BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            e+++lq+k + Ll++l+eVdkrY qy++q+q+++s F+a+ag+g+akpYt lAl++iSrhFrc++dai++qi
  GSMUA_Achr3P29230_001 235 EKEDLQNKVSNLLQMLDEVDKRYAQYYHQMQIIVSWFDAIAGCGAAKPYTVLALQTISRHFRCVRDAISGQI 306
                            5789*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.7E-52177304IPR006563POX domain
PfamPF075262.0E-43183303IPR006563POX domain
PROSITE profilePS5007112.244350413IPR001356Homeobox domain
CDDcd000866.60E-12353414No hitNo description
SMARTSM003893.6E-9353417IPR001356Homeobox domain
SuperFamilySSF466891.41E-17354420IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-28356419IPR009057Homeodomain-like
PfamPF059204.2E-17370409IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MYLSFSNSGS YADALAGSTQ TQQNRNELPV TTTIISQGMA VGNSNEVTSL HGDHAYNTWK  60
DGRNEMLFMH SVEGSINGAD VLIHPDDHQV SLQTQLGIIN GQSSSLQHSN VSTMQNQALS  120
LSLSTQMPVP SIQYHPTSLD ISFIDSHQLT SGTVGPLREE SFQNKSMHGN VSPNELSSLT  180
SLIPNSKYLR PAQELLDEVV NVRKALRPKT DRSQMMASNP QEAAANCSSG LSASEKEDLQ  240
NKVSNLLQML DEVDKRYAQY YHQMQIIVSW FDAIAGCGAA KPYTVLALQT ISRHFRCVRD  300
AISGQIQATR KSLGEPEDLS GSSSGLSRLR YIDQQLRQQR TLHQYGLMQQ HSWRPQRGLP  360
ESSVSILRAW LFEHFLHPYP KDSEKLVLAR QTGLTRSQVS NWFINARVRL WKPMIENMYK  420
EEFGDTEIDS NSSLSNPPKL NEDIQPSEDH ED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16359416562Homeobox protein Meis2
3k2a_B2e-16359416562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009394462.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9SIW11e-120BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLM0SIT90.0M0SIT9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P29230_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-112BEL1-like homeodomain 7